Pay in 4 interest-free payments of $6.71 Learn more
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
Cell 7 , 571583 (2004)
Moreover, this approach reduced drug toxicitya critical advantage for clinical applications [32]
Klose, R
If the powder does not fully dissolve in the first two to three minutes of swirling, stop and let the vial rest for one to two minutes, then swirl again
Like sermorelin, CJC-1295 works by binding to GHRH receptors on the pituitary gland to stimulate the body's own growth hormone production
IGF-1 DES Structure Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA Molecular Formula: C 319 H 495 N 91 O 96 S 7 Molecular Weight: 7365.4225 g/mol PubChem CID: 135331146 CAS Number: 112603-35-7 Synonyms: Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1 IGF-1 DES Research IGF-1 DES Is More Potent Than IGF-1 IGF-1 DES is lacking just three amino acids from its N-terminal end, but that subtle change makes a big difference
US$ 24.93
US$ 22.18
US$ 27.08
US$ 28.79
US$ 26.89
